Edit |   |
---|---|
Antigenic Specificity | SDCBP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SDCBP polyclonal antibody, unconjugated |
Immunogen | SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV |
Other Names | MDA-9|ST1|SYCL|TACIP18|melanoma differentiation associated protein-9|melanoma differentiation-associated protein 9|pro-TGF-alpha cytoplasmic domain-interacting protein 18|scaffold protein Pbp1|syndecan-binding protein 1|syntenin-1|syndecan binding protein|SDCBP|Syndecan Binding Protein (Syntenin)|syndecan interacting protein|syntenin|MGC81274|syndecan binding protein L homeolog|sdcbp.L|LOC732879|wu:fc51c03|wu:fk31e01|zgc:55679|zgc:77716|syndecan binding protein (syntenin) 2|sdcbp2|sb:eu862|si:dkey-235k4.1|syntenin-b |
Gene, Accession # | Gene ID: 6386, 53378, 83841, 482977 |
Catalog # | ABIN630291 |
Price | $902 |
Order / More Info | SDCBP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |