Edit |   |
---|---|
Antigenic Specificity | IGFLR1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IGFLR1 polyclonal antibody, unconjugated |
Immunogen | TMEM149 antibody was raised using the N terminal of TMEM149 corresponding to a region with amino acids WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP |
Other Names | IGF-like family receptor 1|IGFLR1 |
Gene, Accession # | Gene ID: 199746 |
Catalog # | ABIN635834 |
Price | $1020 |
Order / More Info | IGFLR1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |