Edit |   |
---|---|
Antigenic Specificity | CD40 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CD40 polyclonal antibody, unconjugated |
Immunogen | CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Other Names | Bp50|CDW40|TNFRSF5|p50|B cell surface antigen CD40|B cell-associated molecule|B-cell surface antigen CD40|CD40 antigen (TNF receptor superfamily member 5)|CD40 type II isoform|CD40L receptor|nerve growth factor receptor-related B-lymphocyte activation molecule|tumor necrosis factor receptor superfamily member 5|tumor necrosis factor receptor superfamily|member 5|CD40 molecule|CD40|AI326936|GP39|HIGM1|IGM|IMD3|T-BAM|TRAP|T-cell differentiation antigen|CD40 antigen|TNFSF5|human CD40-homologue|TNF receptor superfamily member 5 |
Gene, Accession # | Gene ID: 958 |
Catalog # | ABIN634498 |
Price | $1020 |
Order / More Info | CD40 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |