Edit |   |
---|---|
Antigenic Specificity | RASGRF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RASGRF1 polyclonal antibody, unconjugated |
Immunogen | RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG |
Other Names | CDC25|CDC25L|GNRP|GRF1|GRF55|H-GRF55|PP13187|ras-GRF1|Ras-specific guanine nucleotide-releasing factor|CDC25 homolog|Ras-specific nucleotide exchange factor CDC25|guanine nucleotide exchange factor|guanine nucleotide-releasing factor 1|guanine nucleotide-releasing factor|55 kD|guanine nucleotide-releasing protein|ras-specific guanine nucleotide-releasing factor 1|Ras protein specific guanine nucleotide releasing factor 1|RASGRF1|Ras Protein-Specific Guanine Nucleotide-Releasing Factor 1|AI844718|CDC25Mm|Grfbeta|P190-A|p190|p190RhoGEF|GRF beta|Ras guanine release factor beta|guanine nucleotide releasing factor 1|P140 RAS-GRF|Ras protein specific guanine nucleotide releasing factor 1 S homeolog|rasgrf1.S|si:ch211-234p18.3|ras-specific guanine nucleotide-releasing factor 1-like |
Gene, Accession # | Gene ID: 5923 |
Catalog # | ABIN634389 |
Price | $1020 |
Order / More Info | RASGRF1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |