Edit |   |
---|---|
Antigenic Specificity | RALYL |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RALYL polyclonal antibody, unconjugated |
Immunogen | RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD |
Other Names | HNRPCL3|RNA-binding Raly-like protein|hRALYL|heterogeneous nuclear ribonucleoprotein C-like 3|hnRNP core protein C-like 3|RALY RNA binding protein like|RALYL|RALY RNA Binding Protein-Like|0710005M24Rik|RGD1305844|LOC100225950|LOC100330501 |
Gene, Accession # | Gene ID: 138046 |
Catalog # | ABIN633555 |
Price | $1020 |
Order / More Info | RALYL Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |