Edit |   |
---|---|
Antigenic Specificity | SAAL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SAAL1 polyclonal antibody, unconjugated |
Immunogen | SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE |
Other Names | 5031425D22Rik|SPACIA1|protein SAAL1|synoviocyte proliferation-associated in collagen-induced arthritis 1|serum amyloid A-like 1|Saal1|serum amyloid A like 1|zgc:55505|serum amyloid A-3 protein|serum amyloid A like 1 L homeolog|saal1.L |
Gene, Accession # | Gene ID: 113174 |
Catalog # | ABIN633143 |
Price | $1020 |
Order / More Info | SAAL1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |