Edit |   |
---|---|
Antigenic Specificity | Neuropilin 1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Neuropilin 1 polyclonal antibody, unconjugated |
Immunogen | Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids GIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE |
Other Names | BDCA4|CD304|NP1|NRP|VEGF165R|neuropilin-1|transmembrane receptor|vascular endothelial cell growth factor 165 receptor|neuropilin 1|NRP1|C530029I03|NP-1|NPN-1|Npn1|A5 protein|Neuropilin-1 precursor (A5 protein)|neuropilin|nrp-1|A5 antigen|A5-protein|neuropilin 1 L homeolog|nrp1.L|npn-1A|zgc:111785|zgc:136674|znrp1|neuropilin-1a|neuropilin 1a|nrp1a|LOW QUALITY PROTEIN: neuropilin-1 |
Gene, Accession # | Gene ID: 8829, 18186 |
Catalog # | ABIN635859 |
Price | $1020 |
Order / More Info | Neuropilin 1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |