Edit |   |
---|---|
Antigenic Specificity | GSTA4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GSTA4 polyclonal antibody, unconjugated |
Immunogen | GSTA4 antibody was raised using the C terminal of GSTA4 corresponding to a region with amino acids LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP |
Other Names | GSTA4-4|GTA4|GST class-alpha member 4|S-(hydroxyalkyl)glutathione lyase A4|glutathione S-alkyltransferase A4|glutathione S-aralkyltransferase A4|glutathione S-aryltransferase A4|glutathione S-transferase A4|glutathione S-transferase A4-4|glutathione transferase A4-4|glutathione S-transferase alpha 4|GSTA4|GST 8-8|GST A4-4|GST K|GST Yk|glutathione S-transferase Yk|glutathione S-transferase alpha-4|glutathione transferase|glutathione S-transferase A3|glutathione S-transferase class-alpha|glutathione S-transferase alpha 4-like|GSTA4L|glutathione S-transferase alpha 4 S homeolog|gsta4.S|tGSTA4|glutathione S-transferase alpha class A4|glutathione S-transferase 3|GST5.7|mGsta4|glutathione S-transferase 5.7|glutathione S-transferase, alpha 4|LOC100341622 |
Gene, Accession # | Gene ID: 2941 |
Catalog # | ABIN631150 |
Price | $1020 |
Order / More Info | GSTA4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |