Edit |   |
---|---|
Antigenic Specificity | IFNA7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IFNA7 polyclonal antibody, unconjugated |
Immunogen | IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
Other Names | IFN-alphaJ|IFNA-J|IFN-alpha 7|IFN-alpha-7|IFN-alpha-J1|interferon alpha-7|interferon alpha-J|interferon alpha-J1|leIF J|interferon alpha 7|IFNA7|Interferon, alpha 7|Ifa7|interferon alpha family|gene 7|CaIFN-alpha 7|IFN-alpha 1|IFN-alpha 2|IFN-alpha-12|interferon alpha-12|interferon-alpha 1|interferon-alpha 2|interferon|alpha 7|LOC741747 |
Gene, Accession # | Gene ID: 3444 |
Catalog # | ABIN634003 |
Price | $1020 |
Order / More Info | IFNA7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |