Edit |   |
---|---|
Antigenic Specificity | NOLC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | arabidopsis, dog, Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NOLC1 polyclonal antibody, unconjugated |
Immunogen | NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
Other Names | NOPP130|NOPP140|NS5ATP13|P130|140 kDa nucleolar phosphoprotein|HCV NS5A trans-regulated protein 13|HCV NS5A-transactivated protein 13|hepatitis C virus NS5A-transactivated protein 13|nucleolar 130 kDa protein|nucleolar and coiled-body phosphprotein 1|nucleolar phosphoprotein p130|nucleolar protein p130|nucleolar and coiled-body phosphoprotein 1|NOLC1|nucleolar phosphoprotein 140|3230402K17Rik|AA408077|AA536818|AU046071|mKIAA0035|fd05f01|fi49h02|nolc1l|wu:fd05f01|wu:fi49h02|tcof1|DKFZp459M126|xNopp180|nucleolar phosphoprotein|nucleolar and coiled-body phosphoprotein 1 L homeolog|nolc1.L |
Gene, Accession # | Gene ID: 9221, 64896, 70769, 609496 |
Catalog # | ABIN630195 |
Price | $902 |
Order / More Info | NOLC1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |