Edit |   |
---|---|
Antigenic Specificity | TIA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TIA1 polyclonal antibody, unconjugated |
Immunogen | TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED |
Other Names | TIA-1|WDM|T-cell-restricted intracellular antigen-1|nucleolysin TIA-1 isoform p40|p40-TIA-1 (containing p15-TIA-1)|TIA1 cytotoxic granule associated RNA binding protein|TIA1|TIA1 Cytotoxic Granule-Associated RNA Binding Protein|PTRG_10065|hypothetical protein|PGTG_08590|2310050N03Rik|AI256674|mTIA-1|RNA-binding protein TIA-1|cytotoxic granule-associated RNA-binding protein 1|nucleolysin TIA-1|cytotoxic granule-associated RNA binding protein 1|nucleolysin TIAR|LOC5568274|CpipJ_CPIJ013665|VDBG_07004|MGYG_03339|Tsp_15456|TIA1 cytotoxic granule-associated RNA binding protein L homeolog|tia1.L|TIAL1|TIAR|TIA1 cytotoxic granule-associated RNA binding protein-like 1|fb73d10|wu:fb73d10|wu:fc02b04|zgc:55520 |
Gene, Accession # | Gene ID: 7072, 21841 |
Catalog # | ABIN633608 |
Price | $1020 |
Order / More Info | TIA1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |