Edit |   |
---|---|
Antigenic Specificity | SH2D3C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SH2D3C polyclonal antibody, unconjugated |
Immunogen | SH2 D2 antibody was raised using the N terminal of SH2 2 corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
Other Names | CHAT|NSP3|PRO34088|SHEP1|SH2 domain-containing Eph receptor-binding protein 1|SH2 domain-containing protein 3C|novel SH2-containing protein 3|SH2 domain containing 3C|SH2D3C|CasHEF1-associated signal transducer|SH2 domain containing 3C L homeolog|sh2d3c.L|zgc:56490|SH2 domain containing 3Cb|sh2d3cb|SH2 domain-containing protein 3C-like|LOC100466471 |
Gene, Accession # | Gene ID: 10044, 27387, 362111 |
Catalog # | ABIN634344 |
Price | $1020 |
Order / More Info | SH2D3C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |