Edit |   |
---|---|
Antigenic Specificity | SNX18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SNX18 polyclonal antibody, unconjugated |
Immunogen | SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD |
Other Names | SH3PX2|SH3PXD3B|SNAG1|SH3 and PX domain-containing protein 3B|sorting nexin associated golgi protein 1|sorting nexin-18|sorting nexin-associated Golgi protein 1|sorting nexin 18|SNX18|MGC82637|sorting nexin 18 L homeolog|snx18.L|sorting nexin 18 S homeolog|snx18.S|si:dkey-193c22.4|snag1a|sorting nexin 18a|snx18a|sorting nexin-18-like|snag1b|sorting nexin 18b|sorting nexin associated golgi protein 1b|snx18b |
Gene, Accession # | Gene ID: 112574 |
Catalog # | ABIN634337 |
Price | $1020 |
Order / More Info | SNX18 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |