Edit |   |
---|---|
Antigenic Specificity | IL13RA2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IL13RA2 polyclonal antibody, unconjugated |
Immunogen | IL13 RA2 antibody was raised using the N terminal of IL13 A2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL |
Other Names | CD213A2|CT19|IL-13R|IL13BP|IL-13 receptor subunit alpha-2|IL-13R subunit alpha-2|IL-13R-alpha-2|IL-13RA2|cancer estis antigen 19|interleukin 13 binding protein|interleukin 13 receptor alpha 2 chain|interleukin-13 receptor subunit alpha-2|interleukin-13-binding protein|interleukin 13 receptor subunit alpha 2|IL13RA2|Interleukin 13 Receptor, alpha 2|sb:cb602|si:dkeyp-110c7.6|interleukin-13 receptor alpha 2|interleukin 13 receptor alpha chain 2|IL-13 receptor alpha 2|interleukin 13 receptor|alpha 2|interleukin 13 receptor subunit alpha 2 S homeolog|il13ra2.S|interleukin-13 receptor subunit alpha-2-like |
Gene, Accession # | Gene ID: 3598, 403622 |
Catalog # | ABIN630522 |
Price | $1020 |
Order / More Info | IL13RA2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |