Edit |   |
---|---|
Antigenic Specificity | Presenilin 2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Presenilin 2 polyclonal antibody, unconjugated |
Immunogen | Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
Other Names | AD3L|AD4|CMD1V|PS2|STM2|AD3LP|AD5|E5-1|PS-2|STM-2|presenilin-2|presenilin 2|PSEN2|Presenilin 2 (Alzheimer Disease 4)|ALG-3|Ad4h|Alg3|Psnl2|pre2|zf-PS2|PS-beta|presenilin beta|presenilin-beta|presenilin 2 S homeolog|psen2.S|protein pS2|trefoil factor 1|Tff1 |
Gene, Accession # | Gene ID: 5664, 19165, 81751, 490382 |
Catalog # | ABIN634258 |
Price | $1020 |
Order / More Info | Presenilin 2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |