Edit |   |
---|---|
Antigenic Specificity | Cytokeratin 13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Cytokeratin 13 polyclonal antibody, unconjugated |
Immunogen | Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP |
Other Names | CK13|K13|CK-13|cytokeratin 13|cytokeratin-13|keratin|type I cytoskeletal 13|keratin-13|keratin 13|KRT13|Krt-1.13|Krt1-13|47 kDa cytokeratin|keratin complex 1|acidic|gene 13|Ka13|type I keratin KA13|keratin 13, type I S homeolog|krt13.S|keratin 24|krt24|type I|keratin, type I cytoskeletal 13|LOC101117431|LOC100515166|LOC100344183 |
Gene, Accession # | Gene ID: 3860, 16663, 287699 |
Catalog # | ABIN629751 |
Price | $902 |
Order / More Info | Cytokeratin 13 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |