Edit |   |
---|---|
Antigenic Specificity | CLEC4M |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CLEC4M polyclonal antibody, unconjugated |
Immunogen | CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV |
Other Names | CD209L|CD299|DC-SIGN2|DC-SIGNR|DCSIGNR|HP10347|L-SIGN|LSIGN|C-type lectin domain family 4 member M|CD209 antigen-like protein 1|CD299 antigen|DC-SIGN-related protein|dendritic cell-specific ICAM-3-grabbing non-integrin 2|liverlymph node-specific ICAM-3 grabbing non-integrin|liverlymph node-specific ICAM-3-grabbing non-integrin|mannose binding C-type lectin DC-SIGNR|CLEC4M|C-Type Lectin Domain Family 4, Member M|CD209B|CD209b antigen |
Gene, Accession # | Gene ID: 10332 |
Catalog # | ABIN630277 |
Price | $902 |
Order / More Info | CLEC4M Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |