Edit |   |
---|---|
Antigenic Specificity | ATPAF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATPAF1 polyclonal antibody, unconjugated |
Immunogen | ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI |
Other Names | ATP11|ATP11p|homolog of yeast ATP11|ATP synthase mitochondrial F1 complex assembly factor 1|ATPAF1|6330547J17Rik|AI593252|id:ibd1136|si:dkey-171o17.2|zgc:110583|T14G11.17|T14G11_17|ATP synthase F1 complex assembly factor|AT2G34050 |
Gene, Accession # | Gene ID: 64756 |
Catalog # | ABIN633038 |
Price | $1020 |
Order / More Info | ATPAF1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |