Edit |   |
---|---|
Antigenic Specificity | CD68 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | unconjugated |
Size | 20 µL |
Concentration | n/a |
Applications | Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CD68 polyclonal antibody, unconjugated |
Immunogen | Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag |
Other Names | GP110|LAMP4|SCARD1|CD68 antigen|macrophage antigen CD68|macrosialin|scavenger receptor class D|member 1|CD68 molecule|CD68|macrosialin-like protein |
Gene, Accession # | Gene ID: 968, 12514 |
Catalog # | ABIN7442818 |
Price | $183 |
Order / More Info | CD68 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |