Edit |   |
---|---|
Antigenic Specificity | C1orf190 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C1orf190 polyclonal antibody, unconjugated |
Immunogen | C1 ORF190 antibody was raised using the middle region of C1 rf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL |
Other Names | C1orf190|LRAP35a|LRP35A|NF-kappa-B activator C1orf190|leucine repeat adapter protein 35A|leucine repeat adaptor protein 35a|leucine rich adaptor protein 1|LURAP1|Chromosome 1 Open Reading Frame 190|C8H1orf190|RGD1566001|NF-kappa-B activator C1orf190 homolog|adaptor protein LRAP35a|1520402A15Rik |
Gene, Accession # | Gene ID: 541468 |
Catalog # | ABIN632875 |
Price | $1020 |
Order / More Info | C1orf190 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |