Edit |   |
---|---|
Antigenic Specificity | CALCRL |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CALCRL polyclonal antibody, unconjugated |
Immunogen | CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL |
Other Names | CGRPR|CRLR|CGRP type 1 receptor|calcitonin gene-related peptide type 1 receptor|calcitonin receptor-like receptor|calcitonin receptor like receptor|CALCRL|Calcitonin Receptor-Like|CLR|RATCRLR|RNCLR|AV071593|calcitonin receptor like receptor L homeolog|calcrl.L|calcitonin gene-related peptide type 1 receptor-like|LOC100168906|im:7141310|zgc:100872|CALCRL1|CLR1|CRLR1|crlr-1|calcitonin receptor-like a|calcrla|calcitonin-like peptide type 1 receptor |
Gene, Accession # | Gene ID: 10203, 25029, 54598 |
Catalog # | ABIN634576 |
Price | $1020 |
Order / More Info | CALCRL Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |