Edit |   |
---|---|
Antigenic Specificity | PPP1R13B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PPP1R13B polyclonal antibody, unconjugated |
Immunogen | PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA |
Other Names | ASPP1|p53BP2-like|p85|apoptosis-stimulating of p53 protein 1|apoptosis-stimulating protein of p53|1|protein phosphatase 1 regulatory subunit 13B|protein phosphatase 1|regulatory (inhibitor) subunit 13B|PPP1R13B|Protein Phosphatase 1, Regulatory Subunit 13B|protein phosphatase 1 regulatory subunit 13B L homeolog|ppp1r13b.L|protein phosphatase 1, regulatory subunit 13Bb|ppp1r13bb|apoptosis-stimulating of p53 protein 1-like|AI449786|AW545810|Tp53bp2|Trp53bp2|transformation related protein 53 binding protein 2|tumor protein p53 binding protein|2|tumor protein p53-binding protein|protein phosphatase 1, regulatory (inhibitor) subunit 13B |
Gene, Accession # | Gene ID: 21981, 23368, 314465 |
Catalog # | ABIN634596 |
Price | $1020 |
Order / More Info | PPP1R13B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |