Edit |   |
---|---|
Antigenic Specificity | CD5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CD5 polyclonal antibody, unconjugated |
Immunogen | CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV |
Other Names | LEU1|T1|CD5 antigen (p56-62)|T-cell surface glycoprotein CD5|lymphocyte antigen T1Leu-1|CD5 molecule|CD5|Ly-1|Ly-12|Ly-A|Lyt-1|lymphocyte antigen 1|CD5 antigen|Lymphocyte antigen CD5|CD74 antigen|invariant polypeptide of major|lymphocyte receptor CD5|t-cell surface glycoprotein CD5-like|CD5 molecule like|CD5L |
Gene, Accession # | Gene ID: 921 |
Catalog # | ABIN634761 |
Price | $1020 |
Order / More Info | CD5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |