Edit |   |
---|---|
Antigenic Specificity | RBM14 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RBM14 polyclonal antibody, unconjugated |
Immunogen | RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD |
Other Names | COAA|PSP2|SIP|SYTIP1|TMEM137|RNA-binding protein 14|RRM-containing coactivator activatormodulator|SYT-interacting protein|paraspeckle protein 2|synaptotagmin-interacting protein|transmembrane protein 137|RNA binding motif protein 14|RBM14|1300007E16Rik|Sytip|p16|p16K|RNA-binding motif protein 14|synaptotagmin interacting protein|coactivator activator|im:7053198|wu:fc08a04|zgc:110682|RNA binding motif protein 14a|rbm14a|MGC132117|MGC52864|RNA binding motif protein 14 L homeolog|rbm14.L|MGC75876|zgc:85696|RNA binding motif protein 14b|rbm14b|RBM4|RNA binding motif protein 4|RNA-binding protein 4|RNA-binding protein 4B|LOC100717548|rbm14-b|RNA binding motif protein 14 S homeolog|rbm14.S |
Gene, Accession # | Gene ID: 10432, 56275, 170900 |
Catalog # | ABIN634248 |
Price | $1020 |
Order / More Info | RBM14 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |