Edit |   |
---|---|
Antigenic Specificity | CACNA1G |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CACNA1G polyclonal antibody, unconjugated |
Immunogen | CACNA1 G antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
Other Names | Ca(V)T.1|Cav3.1|NBR13|cav3.1c|voltage-dependent T-type calcium channel subunit alpha-1G|voltage-dependent calcium channel alpha 1G subunit|voltage-gated calcium channel subunit alpha Cav3.1|calcium voltage-gated channel subunit alpha1 G|CACNA1G|Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit|Cav3.1d|a1G|alpha-1G|mKIAA1123|calcium channel|voltage-dependent|alpha 1G subunit|Ca(v)3.1|T type|calcium channel voltage-dependent T type Cav3.1|calcium channel, voltage-dependent, T type, alpha 1G subunit L homeolog|cacna1g.L |
Gene, Accession # | Gene ID: 8913 |
Catalog # | ABIN633723 |
Price | $1020 |
Order / More Info | CACNA1G Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |