Edit |   |
---|---|
Antigenic Specificity | ST3GAL5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ST3GAL5 polyclonal antibody, unconjugated |
Immunogen | ST3 GAL5 antibody was raised using the N terminal of ST3 AL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS |
Other Names | SATI|SIAT9|SIATGM3S|ST3GalV|CMP-NeuAc:lactosylceramide alpha-2|3-sialyltransferase|GM3 synthase|ST3Gal V|alpha 2|3-sialyltransferase V|ganglioside GM3 synthase|lactosylceramide alpha-2|sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2|3-sialyltransferase; GM3 synthase)|ST3 beta-galactoside alpha-2,3-sialyltransferase 5|ST3GAL5|3S-T|a2|GM3-specific sialytransferase|mST3Gal V|3-sialyltransferase)|ST3GAL-V|alpha2|sialyltransferase 9|wu:fc08a12|st3gal5-r1|zST3GalV-1 |
Gene, Accession # | Gene ID: 8869, 20454, 83505 |
Catalog # | ABIN630451 |
Price | $902 |
Order / More Info | ST3GAL5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |