Edit |   |
---|---|
Antigenic Specificity | STIP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-STIP1 polyclonal antibody, unconjugated |
Immunogen | STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS |
Other Names | HOP|IEF-SSP-3521|P60|STI1|STI1L|Hsp70Hsp90-organizing protein|NY-REN-11 antigen|hsc70Hsp90-organizing protein|renal carcinoma antigen NY-REN-11|transformation-sensitive protein IEF SSP 3521|stress induced phosphoprotein 1|STIP1|Stress-Induced-phosphoprotein 1|Hsp70Hsp90 organizing protein|IEF SSP 3521|mSTI1|stress-inducible protein|stress-induced phosphoprotein 1|stress-induced-phosphoprotein 1 (Hsp70Hsp90-organizing protein)|MGC53256|stress induced phosphoprotein 1 L homeolog|stip1.L|GL50803_27310|PGTG_06468|MGC76181|MGC82554|stress induced phosphoprotein 1 S homeolog|stip1.S|zgc:92133 |
Gene, Accession # | Gene ID: 64168, 64169, 69352, 477530 |
Catalog # | ABIN629862 |
Price | $902 |
Order / More Info | STIP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |