Edit |   |
---|---|
Antigenic Specificity | B4GALT3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-B4GALT3 polyclonal antibody, unconjugated |
Immunogen | B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN |
Other Names | UDP-Gal:betaGlcNAc beta 1|4- galactosyltransferase 3|beta-1|4-galactosyltransferase 3|beta-1,4-galactosyltransferase 3|B4GALT3|UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3|UDP-Gal:beta-GlcNAc beta-1|UDP-galactose:beta-N-acetylglucosamine beta-1|b4Gal-T3|4-GalTase 3|beta4Gal-T3|beta-N-acetylglucosaminyl-glycolipid beta-1|UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog|b4galt3.S|9530061M23Rik|AA104562|AW125175|ESTM26|ESTM6|R74981|N-acetyllactosamine synthase|4-galactosyltransferase|polypeptide 3; beta-1|4-galactosyltransferase III; beta4GalT-III; expressed sequence tag mouse EST 6|4-galactosyltransferase III|beta4GalT-III|UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3|4- galactosyltransferase|polypeptide 3 |
Gene, Accession # | Gene ID: 5737, 57370, 494342 |
Catalog # | ABIN635885 |
Price | $1020 |
Order / More Info | B4GALT3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |