Edit |   |
---|---|
Antigenic Specificity | EN1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EN1 polyclonal antibody, unconjugated |
Immunogen | EN1 antibody was raised using the C terminal of EN1 corresponding to a region with amino acids LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
Other Names | engrailed homolog 1|homeobox protein en-1|homeobox protein engrailed-1|hu-En-1|engrailed homeobox 1|EN1|En-1|Mo-en.1|engrailed-1|mo-En-1|engrailed 1|engrailed|en1-A|eng1|xen1|engrailed homeobox 1 S homeolog|en1.S|ENG-1|zgc:100771|homeobox protein en-1a|homeobox protein engrailed-1a|engrailed homeobox 1a|en1a|Gg-En-1|en-3|Engrailed-3|En-1A|en1-b|En-1a homeobox protein|Homeobox protein en-1-A|Homeobox protein engrailed-1-A|engrailed homeobox 1 L homeolog|en1.L |
Gene, Accession # | Gene ID: 2019 |
Catalog # | ABIN632046 |
Price | $1020 |
Order / More Info | EN1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |