Edit |   |
---|---|
Antigenic Specificity | C17orf78 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-C17orf78 polyclonal antibody, unconjugated |
Immunogen | C17 ORF78 antibody was raised using the middle region of C17 rf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA |
Other Names | uncharacterized protein C17orf78|chromosome 17 open reading frame 78|C17orf78|Chromosome 17 Open Reading Frame78 |
Gene, Accession # | Gene ID: 284099 |
Catalog # | ABIN635579 |
Price | $1020 |
Order / More Info | C17orf78 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |