Edit |   |
---|---|
Antigenic Specificity | ST3GAL4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ST3GAL4 polyclonal antibody, unconjugated |
Immunogen | ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV |
Other Names | CGS23|NANTA3|SAT3|SIAT4|SIAT4C|ST3GalIV|STZ|CMP-N-acetylneuraminate-beta-galactosamide-alpha-2|3-sialyltransferase 4|SAT-3|SIAT4-C|ST-4|ST3GalA.2|alpha 2|3-ST 4|3-sialyltransferase IV|alpha-3-N-acetylneuraminyltransferase|beta-galactoside alpha-2|gal-NAc6S|gal-beta-1|4-GalNAc-alpha-2|3-sialyltransferase|sialyltransferase 4C (beta-galactosidase alpha-2|3-sialytransferase)|sialyltransferase 4C (beta-galactoside alpha-2|ST3 beta-galactoside alpha-2,3-sialyltransferase 4|ST3GAL4|ST3Gal IV|alpha-2|3-sialyltransferase ST3Gal IV|sialyltransferase 4C|ST3GAL-IV|alpha2|im:7151092|zgc:158162|ST3 beta-galactoside alpha-2,3-sialyltransferase 4 L homeolog|st3gal4.L|ST3 beta-galactoside alpha-2 |
Gene, Accession # | Gene ID: 6484, 20443, 363040, 607094 |
Catalog # | ABIN635964 |
Price | $1020 |
Order / More Info | ST3GAL4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |