Edit |   |
---|---|
Antigenic Specificity | MPZL2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MPZL2 polyclonal antibody, unconjugated |
Immunogen | MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF |
Other Names | cb837|eva1|mpzl2|wu:fb07b02|epithelial V-like antigen 1|myelin protein zero-like 2|myelin protein zero-like protein 2|myelin protein zero-like 2b|mpzl2b|myelin protein zero like 2|Eva|myelin protein zero-like 2 L homeolog|mpzl2.L |
Gene, Accession # | Gene ID: 10205, 14012, 300679 |
Catalog # | ABIN634708 |
Price | $1020 |
Order / More Info | MPZL2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |