Edit |   |
---|---|
Antigenic Specificity | EXOSC6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-EXOSC6 polyclonal antibody, unconjugated |
Immunogen | EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG |
Other Names | EAP4|MTR3|Mtr3p|hMtr3p|p11|Mtr3 (mRNA transport regulator 3)-homolog|exosome complex component MTR3|exosome complex exonuclease MTR3|hMtr3|homolog of yeast mRNA transport regulator 3|mRNA transport regulator 3 homolog|exosome component 6|EXOSC6|2610510N21Rik|C76919|id:ibd1130|wu:fe17d05|zgc:110071|RAR-gamma|CpipJ_CPIJ018071|mRNA transport regulator 3 |
Gene, Accession # | Gene ID: 72544, 118460, 307850, 489713 |
Catalog # | ABIN633462 |
Price | $1020 |
Order / More Info | EXOSC6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |