Edit |   |
---|---|
Antigenic Specificity | Renin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Renin polyclonal antibody, unconjugated |
Immunogen | Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
Other Names | HNFJ2|angiotensin-forming enzyme|angiotensinogenase|renin precursor|renal|renin|REN|prorenin|RATRENAA|RENAA|Ren1|renin 1 structural|renin-like|preprorenin|D19352|Ren-1|Ren-A|Ren1c|Ren1d|Rn-1|Rnr|aspartyl-protease|kidney renin|renin b|renin-1|cathepsin E |
Gene, Accession # | Gene ID: 5972, 24715, 216858 |
Catalog # | ABIN630157 |
Price | $902 |
Order / More Info | Renin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |