Edit |   |
---|---|
Antigenic Specificity | LYPD4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LYPD4 polyclonal antibody, unconjugated |
Immunogen | LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM |
Other Names | SMR|ly6PLAUR domain-containing protein 4|sperm membrane receptor|LY6/PLAUR domain containing 4|LYPD4|4933400F01Rik|rCG53718|LY6PLAUR domain containing 4 |
Gene, Accession # | Gene ID: 147719 |
Catalog # | ABIN634028 |
Price | $1020 |
Order / More Info | LYPD4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |