Edit |   |
---|---|
Antigenic Specificity | ITGBL1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ITGBL1 polyclonal antibody, unconjugated |
Immunogen | ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR |
Other Names | OSCP|TIED|integrin beta-like protein 1|osteoblast-specific cysteine-rich protein|ten integrin EGF-like repeat domain-containing protein|integrin subunit beta like 1|ITGBL1|Integrin, beta-Like 1 (With EGF-Like Repeat Domains)|similar to integrin|beta-like 1 (with EGF-like repeat domains)|integrin subunit beta like 1 L homeolog|itgbl1.L|integrin|integrin beta-like protein 1-like|B930011D01Rik|with EGF-like repeat domains|integrin, beta-like 1|zgc:112304 |
Gene, Accession # | Gene ID: 9358, 485536 |
Catalog # | ABIN630272 |
Price | $902 |
Order / More Info | ITGBL1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |