Edit |   |
---|---|
Antigenic Specificity | KCNQ1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KCNQ1 polyclonal antibody, unconjugated |
Immunogen | KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Other Names | ATFB1|ATFB3|JLNS1|KCNA8|KCNA9|KVLQT1|Kv1.9|Kv7.1|LQT|LQT1|RWS|SQT2|WRS|IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1|kidney and cardiac voltage dependend K+ channel|potassium voltage-gated channel subfamily KQT member 1|slow delayed rectifier channel subunit|voltage-gated potassium channel subunit Kv7.1|potassium voltage-gated channel subfamily Q member 1|KCNQ1|Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1|CG12215|CG12915|CG33135|DKCNQ|DmelCG33135|CG33135-PC|CG33135-PD|CG33135-PE|CG33135-PF|CG33135-PG|CG33135-PH|CG33135-PI|CG33135-PJ|CG33135-PK|KCNQ-PC|KCNQ-PD|KCNQ-PE|KCNQ-PF|KCNQ-PG|KCNQ-PH|KCNQ-PI|KCNQ-PJ|KCNQ-PK|KCNQ-type K+ channel|KCNQ potassium channel|KCNQ|potassium channel protein (KvLQT1)|ventricular voltage-gated K+ channel pore-forming subunit KCNQ1|kqt-3|KvLQT1 voltage-gated delayed rectifier potassium channel|potassium voltage-gated channel|KQT-like subfamily|member 1|potassium channel protein KCNQ1|subfamily Q|potassium channel, voltage gated KQT-like subfamily Q, member 1|voltage gated potassium channel subunit|KQT-like 1|KvLQT-1|kcnq1-A|xkvlqt1|IKs producing slow voltage-gated potassium channel subunit alpha xKvLQT1|potassium channel, voltage gated KQT-like subfamily Q, member 1 L homeolog|kcnq1.L|zgc:158384|AW559127|potassium voltage-gated channel, subfamily Q, member 1|potassium channel protein |
Gene, Accession # | Gene ID: 3784, 16535, 84020 |
Catalog # | ABIN630110 |
Price | $902 |
Order / More Info | KCNQ1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |