Edit |   |
---|---|
Antigenic Specificity | FBP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FBP1 polyclonal antibody, unconjugated |
Immunogen | FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Other Names | FBP|D-fructose-1|6-bisphosphate 1-phosphohydrolase 1|FBPase 1|fructose-bisphosphatase 1|growth-inhibiting protein 17|FBP1|Fructose-1,6-Bisphosphatase 1|Fbp-2|Fbp2|Fbp3|6-bisphosphate 1-phosphohydrolase 3|FBPase brain isoform|FBPase liver|fructose-1|6-bisphosphatase 1|6-bisphosphatase isozyme 3|fructose bisphosphatase 1|fructose 1|6-bisphosphatase|Fructose-1,6-bisphosphatase|LOC100136618|fructose-bisphosphatase class I|RR_RS07410|Fdp|Fructose-16- biphosphatase|6- biphosphatase 1|CG10611|CG31692|DmelCG31692|FbPase|CG31692-PA|CG31692-PB|fbp-PA|fbp-PB|cb598|fb57b01|id:ibd1091|wu:fb17g10|wu:fb57b01|zgc:64127|fb17g10|fructose-1,6-bisphosphatase 1b|fbp1b|xcc-b100_0105|fbp1l|fk92h02|wu:fk92h02|zgc:64096|like|fructose-1,6-bisphosphatase 1a|fbp1a|fbp1.S|fructose-bisphosphatase 1 S homeolog|fructose-bisphosphatase 1 L homeolog|fbp1.L |
Gene, Accession # | Gene ID: 8939, 14121 |
Catalog # | ABIN629795 |
Price | $902 |
Order / More Info | FBP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |