Edit |   |
---|---|
Antigenic Specificity | SH3BP4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SH3BP4 polyclonal antibody, unconjugated |
Immunogen | SH3 BP4 antibody was raised using the N terminal of SH3 P4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS |
Other Names | BOG25|TTP|EH-binding protein 10|SH3 domain-binding protein 4|transferrin receptor trafficking protein|transferrin receptor-trafficking protein|SH3 domain binding protein 4|SH3BP4|SH3-Domain Binding Protein 4|AI594717|AW227605|LOC569399|SH3 domain-binding protein 4-like|SH3 domain-binding protein 4-B|SH3-domain binding protein 4 L homeolog|sh3bp4.L |
Gene, Accession # | Gene ID: 23677 |
Catalog # | ABIN632230 |
Price | $1020 |
Order / More Info | SH3BP4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |