Edit |   |
---|---|
Antigenic Specificity | CIRBP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CIRBP polyclonal antibody, unconjugated |
Immunogen | CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG |
Other Names | CIRP|A18 hnRNP|cold inducible RNA-binding protein|cold-inducible RNA-binding protein|glycine-rich RNA binding protein|glycine-rich RNA-binding protein CIRP|cold inducible RNA binding protein|CIRBP|EDI_107320|R74941|XCIRP|XCIRP-1|cirbp-b|cirbp2|cirp-1|cirp1|Cold-inducible RNA-binding protein-1|Glycine-rich RNA-binding protein CIRP-A|cold-inducible RNA-binding protein 1|cold-inducible RNA-binding protein A|cold inducible RNA binding protein L homeolog|cirbp.L|APBP-1|aggrecan promoter binding protein|cirbp-a|zgc:136559|cold inducible RNA binding protein b|cirbpb|hyperosmotic glycine rich protein-like|cold-inducible RNA binding protein|LOW QUALITY PROTEIN: cold-inducible RNA-binding protein |
Gene, Accession # | Gene ID: 1153 |
Catalog # | ABIN633585 |
Price | $1020 |
Order / More Info | CIRBP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |