Edit |   |
---|---|
Antigenic Specificity | P2RX7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-P2RX7 polyclonal antibody, unconjugated |
Immunogen | P2 RX7 antibody was raised using the N terminal of P2 X7 corresponding to a region with amino acids IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE |
Other Names | AI467586|P2X(7)|P2X7R|ATP receptor|P2X purinoceptor 7|P2X7 purinoceptor|P2X7 receptor|P2Z receptor|purinergic receptor P2X, ligand-gated ion channel, 7|P2rx7|P2X7|purinergic receptor P2X7 variant A|purinergic receptor P2X 7|p2xr7|purinergic receptor P2X|ligand-gated ion channel|7|p2X purinoceptor 7-like|LOC100458463|purinergic receptor P2X7|ligand-gated ion channel 7|ATP gated ion channel|ligand gated ion channel|7 L homeolog|purinergic receptor P2X, ligand gated ion channel, 7 L homeolog|p2rx7.L |
Gene, Accession # | Gene ID: 5027, 18439 |
Catalog # | ABIN630087 |
Price | $902 |
Order / More Info | P2RX7 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |