Edit |   |
---|---|
Antigenic Specificity | FETUB |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FETUB polyclonal antibody, unconjugated |
Immunogen | FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL |
Other Names | 16G2|Gugu|IRL685|fetuin-B|fetuin-like protein IRL685|fetuin B|FETUB|Fet|Pp63|fetuin beta|fetuin phosphoprotein|apo AI promoter B-region binding protein|fetuin B L homeolog|fetub.L|im:6910148|fetuin-B-like|2310011O17Rik|AI255764|D17980 |
Gene, Accession # | Gene ID: 26998 |
Catalog # | ABIN633997 |
Price | $1020 |
Order / More Info | FETUB Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |