Edit |   |
---|---|
Antigenic Specificity | KRT8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KRT8 polyclonal antibody, unconjugated |
Immunogen | Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL |
Other Names | CARD2|CK-8|CK8|CYK8|K2C8|K8|KO|cytokeratin 8|cytokeratin-8|keratin|type II cytoskeletal 8|type-II keratin Kb8|keratin 8|KRT8|AA960620|AL022697|AU019895|EndoA|Krt-2.8|Krt2-8|cytokeratin endo A|keratin complex 2|basic|gene 8|keratin-8|CYKER|KERA|cytokeratin-A|KERATIN8|keratin 8 S homeolog|krt8.S|MGC69490|krt2-5|gene 5|DreK8|cb186|sb:cb186|wu:fa20h05|wu:fa95h10|wu:fb96c06|zf-K8|zfk8|etID33550.23|etID43142.23|etID43142.8|type 2|DKFZp468F2127 |
Gene, Accession # | Gene ID: 3856 |
Catalog # | ABIN631865 |
Price | $1020 |
Order / More Info | KRT8 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |