Edit |   |
---|---|
Antigenic Specificity | FSIP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FSIP1 polyclonal antibody, unconjugated |
Immunogen | FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT |
Other Names | 1700012M13Rik|4933432K11Rik|fibrous sheath-interacting protein 1|Fsip1|Fibrous Sheath Interacting Protein 1|zgc:113106 |
Gene, Accession # | Gene ID: 71313, 161835, 296074 |
Catalog # | ABIN631970 |
Price | $1020 |
Order / More Info | FSIP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |