Edit |   |
---|---|
Antigenic Specificity | RAB1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RAB1A polyclonal antibody, unconjugated |
Immunogen | RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
Other Names | RAB1|YPT1|GTP binding protein Rab1a|member RAS oncogene family|Rab GTPase YPT1 homolog|YPT1-related protein|ras-related protein Rab-1A|RAB1A, member RAS oncogene family|RAB1A|RAB1B|RAS|fb53a02|oncogene|si:zc101n13.3|wu:fb53a02|RAB1A, member RAS oncogene family b|rab1ab|MGC53138|RAB1A, member RAS oncogene family L homeolog|rab1a.L|RAB1B, member RAS oncogene family|AAF55873|CG3320|DRAB1|Dm Rab1|DmRab1|DmelCG3320|dar6|Rab-protein 1|CG3320-PA|Rab1-PA|dendritic arbor reduction 6|CG3320 gene product from transcript CG3320-RA|rab1A protein|PfRab1a|hypothetical protein|DDBDRAFT_0185730|DDBDRAFT_0191476|DDB_0185730|DDB_0191476|Rab GTPase|RNase 5|angiogenin|ribonuclease 5|ANG|Gtbp|Rab-1|mKIAA3012|ras-related YPT1 protein|Ac2-048|Rab1r |
Gene, Accession # | Gene ID: 5861, 19324, 81754, 403774 |
Catalog # | ABIN631433 |
Price | $1020 |
Order / More Info | RAB1A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |