Edit |   |
---|---|
Antigenic Specificity | Retinoblastoma Binding Protein 4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Retinoblastoma Binding Protein 4 polyclonal antibody, unconjugated |
Immunogen | RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK |
Other Names | NURF55|RBAP48|CAF-1 subunit C|CAF-I 48 kDa subunit|CAF-I p48|MSI1 protein homolog|RBBP-4|chromatin assembly factor 1 subunit C|chromatin assembly factor I p48 subunit|chromatin assembly factorCAF-1 p48 subunit|histone-binding protein RBBP4|nucleosome-remodeling factor subunit RBAP48|retinoblastoma-binding protein 4|retinoblastoma-binding protein p48|RB binding protein 4, chromatin remodeling factor|RBBP4|Retinoblastoma Binding Protein 4|154659_at|55|CAF-1|CAF1|CAF1-55|CAF1p55|CG4236|Caf1p55|DmelCG4236|MSI1RbAp48CAC3LIN-53|NURF|NURF-55|Nurf 55|P55|S(ls)3|caf1 p55|d-CAF1|dCAF-1|dCAF-1 p55|dNURF|p55 CAF1|p55NURF-55|p55CAF1|CG4236-PA|CG4236-PB|Caf1-PA|Caf1-PB|Nurf55CAF1|chromatin assembly Factor-1|chromatin assembly factor 1|chromatin assembly factor 1 subunit|chromatin associated factor-1 subunit|nucleosome remodeling factor|nucleosome remodeling factor - 55kD|Chromatin assembly factor 1, p55 subunit|xrbbp4|mRbAp48|CAF-1 p48 subunit|retinoblastoma binding protein 4, chromatin remodeling factor|rbb4-2|wu:fb33a09|wu:fb40e10|zgc:55349|zgc:77854|chCAF-1 p48|chromatin assembly factor 1 p48 subunit|RBBP-4-A|histone-binding protein RBBP4-A|retinoblastoma A associated protein|retinoblastoma-binding protein 4-A|retinoblastoma-binding protein p48-A|retinoblastoma binding protein 4 L homeolog|rbbp4.L|M4E13.110|M4E13_110|MULTICOPY SUPPRESSOR OF IRA1 3|NFC3|NUCLEOSOMECHROMATIN ASSEMBLY FACTOR GROUP C 3|Transducin family protein / WD-40 repeat family protein|MSI3 |
Gene, Accession # | Gene ID: 5928, 19646, 313048 |
Catalog # | ABIN634184 |
Price | $1020 |
Order / More Info | Retinoblastoma Binding Protein 4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |