Edit |   |
---|---|
Antigenic Specificity | Claudin 19 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Claudin 19 polyclonal antibody, unconjugated |
Immunogen | Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV |
Other Names | HOMG5|claudin-19|claudin 19|CLDN19|claudin 19 S homeolog|cldn19.S|zgc:112141 |
Gene, Accession # | Gene ID: 149461 |
Catalog # | ABIN634757 |
Price | $1020 |
Order / More Info | Claudin 19 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |