Edit |   |
---|---|
Antigenic Specificity | Peripherin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Peripherin polyclonal antibody, unconjugated |
Immunogen | PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE |
Other Names | NEF4|PRPH1|neurofilament 4 (57kD)|peripherin|PRPH|peripherin 1|Perf|MGC69454|if3|plasticin|neuronal intermediate filament IF3|peripherin L homeolog|prph.L|zgc:111926 |
Gene, Accession # | Gene ID: 5630, 19132, 24688 |
Catalog # | ABIN631185 |
Price | $1020 |
Order / More Info | Peripherin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |