Edit |   |
---|---|
Antigenic Specificity | DKC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DKC1 polyclonal antibody, unconjugated |
Immunogen | DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG |
Other Names | CBF5|DKC|DKCX|NAP57|NOLA4|XAP101|CBF5 homolog|HACA ribonucleoprotein complex subunit 4|cbf5p homolog|nopp140-associated protein of 57 kDa|nucleolar protein NAP57|nucleolar protein family A member 4|snoRNP protein DKC1|dyskerin pseudouridine synthase 1|DKC1|Dyskeratosis Congenita 1, Dyskerin|dyskerin|microRNA 664b|MIR664B|fv62a07|wu:fa28f10|wu:fc87a02|wu:fi24a05|wu:fv62a07|zgc:110395|fc87a02|fi24a05|dyskeratosis congenita 1|dyskeratosis congenita 1, dyskerin L homeolog|dkc1.L|HACA ribonucleoprotein complex subunit 4-like|BC068171|dyskerin homolog|AtCBF5|AtNAP57|homologue of NAP57 |
Gene, Accession # | Gene ID: 1736 |
Catalog # | ABIN634217 |
Price | $1020 |
Order / More Info | DKC1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |