Edit |   |
---|---|
Antigenic Specificity | NOVA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Target Information: This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]. |
Immunogen | NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
Other Names | Nova-1|RNA-binding protein Nova-1|onconeural ventral antigen 1|paraneoplastic Ri antigen|ventral neuron-specific protein 1|NOVA alternative splicing regulator 1|NOVA1|Neuro-Oncological Ventral Antigen 1|neuro-oncological ventral antigen 1 L homeolog|nova1.L|si:ch211-222c22.9|9430099M15Rik|G630039L02|LOC790874|lipid A export ATP-bindingpermease protein|lipid A export ATP-binding/permease protein |
Gene, Accession # | Gene ID: 4857, 298992, 664883 |
Catalog # | ABIN633405 |
Price | $1020 |
Order / More Info | NOVA1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |